WH0009223M3

Monoclonal Anti-MAGI1 antibody produced in mouse

clone 7B4, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : Anti-AIP3, Anti-BAIAP1, Anti-BAP1, Anti-MAGI1, Anti-TNRC19, Anti-WWP3, Anti-membrane associated guanylate kinase, WW and PDZ domain containing 1
• Numéro MDL: MFCD04040441
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 7B4, monoclonal
• Forme: buffered aqueous solution
• Espèces réactives: mouse, human, rat
• Technique(s): indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotype: IgG1κ
• Numéro d'accès GenBank: NM_004742
• Numéro d'accès UniProt: Q96QZ7
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... MAGI1(9223)

Description

Immunogène

MAGI1 (NP_004733, 761 a.a. ~ 859 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SHSTQVLPEFPPAEAQAPDQTDSSGQKKPDPFKIWAQSRSMYENRPMSPSPASGLSKGEREREINSTNFGECPIPDYQEQDIFLWRKETGFGFRILGGN

Application

Monoclonal Anti-MAGI1 antibody produced in mouse has been used for Western Blotting.

Actions biochimiques/physiologiques

Membrane associated guanylate kinase, WW and PDZ domain containing 1 (MAGI1) acts as a scaffolding protein. It takes part in tight junction formation and binds to β-catenin to suppress the Wnt signaling pathway. The gene encoding it has been linked with schizophrenia and the protein is downregulated in hepatocellular carcinoma.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)