Accéder au contenu
MilliporeSigma
Toutes les photos(4)

Key Documents

WH0002940M1

Sigma-Aldrich

Monoclonal Anti-GSTA3 antibody produced in mouse

clone 1F11, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-GSTA33, Anti-GTA3, Anti-MGC22232, Anti-glutathione S-transferase A3

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

1F11, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... GSTA3(2940)

Description générale

Glutathione S-transferase alpha 3 (GSTA3) has two isoforms, that is cytosolic and membrane-bound, which are encoded by two distinct supergene families. These enzymes are involved in cellular defence against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase belonging to the alpha class genes that are located in a cluster mapped to chromosome 6. Genes of the alpha class are highly related and encode enzymes with glutathione peroxidase activity. However, during evolution, this alpha class gene diverged accumulating mutations in the active site that resulted in differences in substrate specificity and catalytic activity. The enzyme encoded by this gene catalyses the double bond isomerization of precursors for progesterone and testosterone during the biosynthesis of steroid hormones. An additional transcript variant has been identified, but its full length sequence has not been determined. (provided by RefSeq)GSTA3 is a adipocyte differentiation-associated protein. It is expressed in steroidogenic tissues. The protein belongs to the family of detoxifying and cytoprotective enzymes.

Immunogène

GSTA3 (AAH20619, 1 a.a. ~ 222 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGIKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF

Actions biochimiques/physiologiques

Glutathione S-transferase alpha 3 (GSTA3) is involved in the metabolism of electrophilic xenobiotic and endobiotic toxic compounds. It may be used as a target for prescribing medication in steroid hormone-dependent diseases. This protein is related to diseases associated with oxidation-regulating proteins. It is used as a therapeutic target for renal interstitial fibrosis (RIF).

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

GSTA3 attenuates renal interstitial fibrosis by inhibiting TGF-beta-induced tubular epithelial-mesenchymal transition and fibronectin expression
Xiao Y, et al.
PLoS ONE, 11(9), e0160855-e0160855 (2016)
Isomerization of ?5-androstene-3, 17-dione into ?4-androstene-3, 17-dione catalyzed by human glutathione transferase A3-3: a computational study identifies a dual role for glutathione
Dourado DF, et al.
The Journal of Physical Chemistry A, 118(31), 5790-5800 (2014)
Glutathione S-transferase polymorphisms: cancer incidence and therapy
McIlwain CC, et al.
Oncogene, 25(11), 1639-1639 (2006)
Expression of the murine glutathione S-transferase ?(GSTA3) subunit is markedly induced during adipocyte differentiation: activation of the GSTA3 gene promoter by the pro-adipogenic eicosanoid 15-deoxy-?12, 14-prostaglandin J 2
Jowsey IR, et al.
Biochemical and Biophysical Research Communications, 312(4), 1226-1235 (2003)
Françoise Raffalli-Mathieu et al.
The Biochemical journal, 414(1), 103-109 (2008-04-23)
hGSTA3-3 (human Alpha-class glutathione transferase 3-3) efficiently catalyses steroid Delta(5)-Delta(4) double-bond isomerization in vitro, using glutathione as a cofactor. This chemical transformation is an obligatory reaction in the biosynthesis of steroid hormones and follows the oxidation of 3beta-hydroxysteroids catalysed by

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique