Accéder au contenu
MilliporeSigma
Toutes les photos(6)

Principaux documents

WH0002119M2

Sigma-Aldrich

Monoclonal Anti-ETV5 antibody produced in mouse

clone 7C10, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-ERM, Anti-ets variant gene 5 (ets-related molecule)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

7C10, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human, mouse, rat

Technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG1κ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... ETV5(2119)

Description générale

E-twenty-six (Ets) variant gene 5 (ETV5) protein belongs to the polyoma enhancer activator 3 (PEA3) subfamily of ETS transcription factors. The ETV5 gene is located on the human chromosome at 3q27.2.

Immunogène

ETV5 (NP_004445, 181 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPM

Application

Monoclonal Anti-ETV5 antibody produced in mouse has been used in western blotting (1:1000).

Actions biochimiques/physiologiques

E-twenty-six (Ets) variant gene 5 (ETV5) gene is responsible for the survival, proliferation, and self-renewal of spermatogonial stem cells (SSCs). ETV5 protein plays a role in mediating glial cell line-derived neurotrophic factor (GDNF) signaling and induces several genes required for regulating SSC fate. It is involved in limb development and regulates epithelial-mesenchymal transition in several cancer cells. ETV5 protein binds to the conserved GGAA/T motif and regulates gene expression.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Lee Huang et al.
Cancer research, 81(8), 2071-2085 (2021-02-03)
The failure of once promising target-specific therapeutic strategies often arises from redundancies in gene expression pathways. Even with new melanoma treatments, many patients are not responsive or develop resistance, leading to disease progression in terms of growth and metastasis. We
Erik Melén et al.
The Journal of allergy and clinical immunology, 126(3), 631-637 (2010-09-08)
Epidemiologic studies consistently show associations between asthma and obesity. Shared genetics might account for this association. We sought to identify genetic variants associated with both asthma and obesity. On the basis of a literature search, we identified genes from (1)
Beth E Helgeson et al.
Cancer research, 68(1), 73-80 (2008-01-04)
Recurrent gene fusions involving oncogenic ETS transcription factors (including ERG, ETV1, and ETV4) have been identified in a large fraction of prostate cancers. The most common fusions contain the 5' untranslated region of TMPRSS2 fused to ERG. Recently, we identified
Severa Bunda et al.
Nature communications, 10(1), 661-661 (2019-02-10)
Capicua (CIC) is a transcriptional repressor that counteracts activation of genes downstream of receptor tyrosine kinase (RTK)/Ras/ERK signaling. It is well-established that tumorigenesis, especially in glioblastoma (GBM), is attributed to hyperactive RTK/Ras/ERK signaling. While CIC is mutated in other tumors

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique