WH0001268M1

Monoclonal Anti-CNR1 antibody produced in mouse

clone 2F9, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : Anti-CANN6, Anti-CB1, Anti-CB1A, Anti-CB1K5, Anti-CBR, Anti-CNR, Anti-cannabinoid receptor 1 (brain)
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 2F9, monoclonal
• Forme: buffered aqueous solution
• Espèces réactives: human
• Technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotype: IgG2bκ
• Numéro d'accès GenBank: NM_016083
• Numéro d'accès UniProt: P21554
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... CNR1(1268)

Description

Description générale

Cannabinoid receptor 1 (CNR1) also known as the type-1 cannabinoid receptor (CB1), is encoded by the gene mapped to human chromosome 6q15. The encoded protein is a member of the class A G protein-coupled receptor (GPCR) family and is highly expressed in the brain and the central nervous system.

This gene encodes one of two cannabinoid receptors. The cannabinoids, principally delta-9-tetrahydrocannabinol and synthetic analogs, are psychoactive ingredients of marijuana. The cannabinoid receptors are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family, which inhibit adenylate cyclase activity in a dose-dependent, stereoselective and pertussis toxin-sensitive manner. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. Multiple transcript variants encoding two different protein isoforms have been described for this gene. (provided by RefSeq)

Immunogène

CNR1 (NP_057167, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMV

Actions biochimiques/physiologiques

Cannabinoid receptor 1 (CNR1) plays a key role in regulation of the endocannabinoid system (ECS), which is involved in most of the activities of the brain and body. Mutations in the gene has been associated with the development of hebephrenic schizophrenia. Experimental studies hypothesize that aberrations in CNR1 gene increases the risk of susceptibility to substance abuse.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)