SAB5702949

Anti-TET1 Antibody, clone 10S0X1, Rabbit Monoclonal

• Synonyme(s) : LCX, Cxxc6, AA517754, BB001228, D10Ertd17, mKIAA1676, D10Ertd17e, 2510010B09Rik
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 10S0X1, monoclonal
• Forme: liquid
• Poids mol.: 260 kDa
• Espèces réactives: human
• Concentration: 1 mg/mL
• Technique(s): immunohistochemistry: 1:50 - 1:200
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: HNTKSFSSASSTSHLVKDESTDFCPLQASSAETSTCTYSKTASGGFAETSSILHCTMPSGAHSGANAAAGECTGTVQPAEVAAHPHQSLPTADSPVHAEPLTSPSEQLTSNQSNQQLPLLSNSQKLASCQVEDERHPEADEPQHPEDDNLPQLD
• Numéro d'accès UniProt: Q3URK3
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... TET1(52463)

Description

Description générale

Enables methylcytosine dioxygenase activity. Involved in several processes, including dendrite morphogenesis; inner cell mass cell differentiation; and protein O-linked glycosylation. Acts upstream of or within DNA demethylation; regulation of DNA methylation; and regulation of genetic imprinting. Located in nucleus. Is expressed in several structures, including brain; early conceptus; embryo ectoderm; lower urogenital tract; and reproductive system. Orthologous to human TET1 (tet methylcytosine dioxygenase 1).

Immunogène

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 1749-1902 of mouse TET1 (NP_001240786.1).

Application

IHC

Informations sur la sécurité

• Pictogrammes: GHS07,GHS09
• Mention d'avertissement: Warning
• Mentions de danger: H317,H411
• Conseils de prudence: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Classification des risques: Aquatic Chronic 2 - Skin Sens. 1
• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3