SAB5702857

Anti-HSP105/HSPH1 Antibody, clone 9Y7M10, Rabbit Monoclonal

• Synonyme(s) : HSP105, HSP105A, HSP105B, NY-CO-25
• Code UNSPSC : 12352203

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 9Y7M10, monoclonal
• Forme: liquid
• Poids mol.: 105 kDa
• Espèces réactives: human, rat, rat
• Concentration: 0.5 mg/mL
• Technique(s): western blot: 1:500 - 1:2000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: MSVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQQITHANNTVSNFKRFHGRAFNDPFIQKEKENLSYDLVPLKNGGVG
• Numéro d'accès UniProt: Q92598
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... HSPH1(10808)

Description

Description générale

This gene encodes a member of the heat shock protein 70 family of proteins. The encoded protein functions as a nucleotide exchange factor for the molecular chaperone heat shock cognate 71 kDa protein (Hsc70). In addition, this protein plays a distinct but related role as a holdase that inhibits the aggregation of misfolded proteins, including the cystic fibrosis transmembrane conductance regulator (CFTR) protein. Elevated expression of this protein has been observed in numerous human cancers. [provided by RefSeq, Mar 2017]

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HSP105/HSPH1 (Q92598).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1