Accéder au contenu
MilliporeSigma
Toutes les photos(2)

Principaux documents

SAB2104331

Sigma-Aldrich

Anti-LPCAT1 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-AYTL2, Anti-FLJ12443, Anti-PFAAP3, Anti-lpcat

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

59 kDa

Espèces réactives

rat, horse, pig, human, mouse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... LPCAT1(79888)

Immunogène

Synthetic peptide directed towards the middle region of human LPCAT1

Application

Anti-LPCAT1 antibody produced in rabbit is suitable for immunohistochemistry (formalin-fixed, paraffin-embedded sections) and western blot applications.

Actions biochimiques/physiologiques

Lysophosphatidylcholine (LPC) acyltransferase (LPCAT; EC 2.3.1.23) catalyzes the conversion of LPC to phosphatidylcholine (PC) in the remodeling pathway of PC biosynthesis.

Séquence

Synthetic peptide located within the following region: LRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEF

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Rozenn N Lemaitre et al.
Heart rhythm, 11(3), 471-477 (2014-01-15)
There is limited information on genetic factors associated with sudden cardiac arrest (SCA). To assess the association of common variation in genes in fatty acid pathways with SCA risk. We selected 85 candidate genes and 1155 single nucleotide polymorphisms (SNPs)
Yoshifumi Morita et al.
Journal of hepatology, 59(2), 292-299 (2013-04-10)
Several lipid synthesis pathways play important roles in the development and progression of hepatocellular carcinoma (HCC), although the precise molecular mechanisms remain to be elucidated. Here, we show the relationship between HCC progression and alteration of phospholipid composition regulated by

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique