Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Key Documents

SAB2104288

Sigma-Aldrich

Anti-THPO antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-MGC163194, Anti-MGDF, Anti-MKCSF, Anti-ML, Anti-MPLLG

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

35 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... THPO(7066)

Description générale

Thrombopoietin (TPO) is a lineage specific growth factor, produced in the liver, kidney and skeletal muscle. It is an acidic glycoprotein. The gene encoding it is localized on human chromosome 3q27.1.

Immunogène

Synthetic peptide directed towards the middle region of human THPO

Actions biochimiques/physiologiques

Thrombopoietin (TPO) stimulates the proliferation and maturation of megakaryocytes, and promotes increased circulating levels of platelets in vivo. TPO signals through the cellular proto-oncogene (c-mpl) receptor and acts as an important regulator of circulating platelets. High levels of TPO have been observed in patients with aplastic anemia.

Séquence

Synthetic peptide located within the following region: NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTS

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Yoshio Takei
Handbook of Hormones: Comparative Endocrinology for Basic and Clinical Research (2015)
The molecular mechanisms that control thrombopoiesis.
Kaushansky K
The Journal of Clinical Investigation, 115(12), 3339-3347 (2005)
Sebastian Weiterer et al.
PloS one, 9(4), e94164-e94164 (2014-04-16)
Chromatin immunoprecipitation in combination with a genome-wide analysis via high-throughput sequencing is the state of the art method to gain genome-wide representation of histone modification or transcription factor binding profiles. However, chromatin immunoprecipitation analysis in the context of human experimental
Majed J Dasouki et al.
Blood, 122(20), 3440-3449 (2013-10-03)
We recently identified 2 siblings afflicted with idiopathic, autosomal recessive aplastic anemia. Whole-exome sequencing identified a novel homozygous missense mutation in thrombopoietin (THPO, c.112C>T) in both affected siblings. This mutation encodes an arginine to cysteine substitution at residue 38 or

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique