Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Principaux documents

SAB2102180

Sigma-Aldrich

Anti-SLC24A1 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-HsT17412, Anti-KIAA0702, Anti-NCKX, Anti-NCKX1, Anti-Solute carrier family 24 (sodium/potassium/calcium exchanger), member 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

121 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... SLC24A1(9187)

Immunogène

Synthetic peptide directed towards the middle region of human SLC24A1

Actions biochimiques/physiologiques

SLC24A1 belongs to a family of potassium-dependent sodium/calcium exchangers. Members of this family have 2 large hydrophilic loops and 2 sets of multiple transmembrane-spanning segments.SLC24A1 belongs to a family of potassium-dependent sodium/calcium exchangers. Members of this family have 2 large hydrophilic loops and 2 sets of multiple transmembrane-spanning segments (Schnetkamp, 2004 [PubMed 14770312]).[supplied by OMIM].

Séquence

Synthetic peptide located within the following region: EQLSRRPVAKVMALEDLSKPGDGAIAVDELQDNKKLKLPSLLTRGSSSTS

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

S Amer Riazuddin et al.
American journal of human genetics, 87(4), 523-531 (2010-09-21)
Congenital stationary night blindness (CSNB) is a nonprogressive retinal disorder that can be associated with impaired night vision. The last decade has witnessed huge progress in ophthalmic genetics, including the identification of three genes implicated in the pathogenicity of autosomal-recessive

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique