Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Principaux documents

SAB1411909

Sigma-Aldrich

ANTI-IL11 antibody produced in mouse

clone 3C6, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

AGIF, IL-11, IL11

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

3C6, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

indirect ELISA: suitable

Isotype

IgG2bκ

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... IL11(3589)

Description générale

The interleukin 11 (IL11) gene, with five exons spanning 7kb of genomic DNA, is mapped to human chromosome 19q13.42. The encoded protein belongs to the IL-6 family of cytokines. IL-11 is secreted by activated astrocytes.
The protein encoded by this gene is a member of the gp130 family of cytokines. These cytokines drive the assembly of multisubunit receptor complexes, all of which contain at least one molecule of the transmembrane signaling receptor IL6ST (gp130). This cytokine is shown to stimulate the T-cell-dependent development of immunoglobulin-producing B cells. It is also found to support the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells. (provided by RefSeq)

Immunogène

IL11 (NP_000632, 23 a.a.-199 a.a.) partial recombinant protein.

Sequence
GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Actions biochimiques/physiologiques

Interleukin 11 (IL11) stimulates tumorigenesis in conjunction with angiogenesis of the primary tumor and of metastatic progenies at distant organs. IL-11 signaling is considered as a rate-limiting step for the tumorigenesis in the mucosa of the gastrointestinal tract. Thus, inhibition of IL-11 signaling can be considered as an emerging therapeutic strategy for various cancers. In addition, this protein also performs a protective role by increasing platelet recovery and inflammatory responses, in sepsis patients with thrombocytopenia. Mutation in the gene increases the risk of susceptibility to Hirschsprung disease and multiple sclerosis (MS).

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

IL-11 in multiple sclerosis.
Xin Zhang et al.
Oncotarget, 6(32), 32297-32298 (2015-10-10)
L H Kim et al.
Neurogastroenterology and motility : the official journal of the European Gastrointestinal Motility Society, 27(10), 1371-1377 (2015-07-15)
Hirschsprung disease (HSCR) is a congenital and heterogeneous disorder characterized by the absence of enteric ganglia during enteric nervous system (ENS) development. Our recent genome-wide association study has identified a variant (rs6509940) of interleukin-11 (IL-11) as a potential susceptible locus
Bing Wan et al.
Cytokine, 76(2), 138-143 (2015-08-16)
To examine the platelet recovering and anti-inflammatory effects of IL-11 in the treatment of sepsis, accompanied with thrombocytopenia and to investigate the associated mechanisms via a case-control study. 105 patients enrolled for the study were segregated into (1) IL-11 therapy
D McKinley et al.
Genomics, 13(3), 814-819 (1992-07-01)
The genomic sequence of human interleukin-11 (IL11) has been isolated based on its sequence homology with a cDNA clone encoding primate IL11. The human IL11 genomic sequence is 7 kb in length and consists of five exons and four introns.
Cameron N Johnstone et al.
Cytokine & growth factor reviews, 26(5), 489-498 (2015-07-27)
Interleukin (IL)-11 is a member of the IL-6 family of cytokines that is defined by the shared use of the GP130 signal transducing receptor subunit. In addition of its long recognized activities as a hemopoietic growth factor, IL-11 has an

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique