SAB1411621

Anti-CD247 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : CD3-ZETA, CD3H, CD3Q, CD3Z, T3Z, TCRZ
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: antigen 18.7 kDa
• Espèces réactives: human
• Technique(s): proximity ligation assay: suitable; western blot: 1 μg/mL
• Numéro d'accès NCBI: NM_198053
• Numéro d'accès UniProt: P20963
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... CD247(919)

Description

Description générale

T cell antigen receptor ζ chain (CD3 ζ), also known as cluster of differentiation 247 (CD247) gene, spanning 88 kb of genomic DNA, is mapped to human chromosome 1q24.2.

The protein encoded by this gene is T-cell receptor ζ, which together with T-cell receptor α/β and γ/δ heterodimers, and with CD3-γ, -δ and -ε, forms the T-cell receptor-CD3 complex. The ζ chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. (provided by RefSeq)

Immunogène

CD247 (NP_932170.1, 1 a.a. ~ 164 a.a) full-length human protein.

Sequence
MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR

Actions biochimiques/physiologiques

T cell antigen receptor ζ chain (CD3 ζ)/cluster of differentiation 247 (CD247) functions as a key signal transduction component of the T cell antigen receptor (TCR) complex. The encoded protein facilitates optimal effector T-cell function by enhancing receptor expression and signaling. Mutation in the gene increases the risk of susceptibility to systemic lupus erythematosus (SLE). Reduced expression of the gene has been observed in T-cells of cancer, lupus and chronic infectious diseases such as leprosy and tuberculosis patients. CD247 serves as a potent biomarker for determining progression and severity in patients with type 2 diabetes.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable