SAB1404983

Monoclonal Anti-PRKCBP1 antibody produced in mouse

clone 6A12, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : MGC31836, PRKCBP1, PRO2893, RACK7
• Code UNSPSC : 12352203

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 6A12, monoclonal
• Forme: buffered aqueous solution
• Poids mol.: antigen ~36.89 kDa
• Espèces réactives: human
• Technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotype: IgG1κ
• Numéro d'accès NCBI: NM_183048
• Numéro d'accès UniProt: Q9ULU4
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... ZMYND8(23613)

Description

Description générale

The protein encoded by this gene is a receptor for activated C-kinase (RACK) protein. The encoded protein has been shown to bind in vitro to activated protein kinase C beta I. In addition, this protein is a cutaneous T-cell lymphoma-associated antigen. Finally, the protein contains a bromodomain and two zinc fingers, and is thought to be a transcriptional regulator. Multiple transcript variants encoding several different isoforms have been found for this gene. (provided by RefSeq)

Immunogène

ZMYND8 (NP_898869, 601 a.a. ~ 698 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHL

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable