Accéder au contenu
MilliporeSigma
Toutes les photos(2)

Principaux documents

SAB1404825

Sigma-Aldrich

Monoclonal Anti-RBM14 antibody produced in mouse

clone 4E1, ascites fluid

Synonyme(s) :

COAA, DKFZp779J0927, MGC15912, MGC31756, PSP2, SIP, SYTIP1, TMEM137

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

ascites fluid

Type de produit anticorps

primary antibodies

Clone

4E1, monoclonal

Poids mol.

antigen ~38.1 kDa

Espèces réactives

human

Technique(s)

indirect ELISA: suitable
western blot: 1:500-1:1000

Isotype

IgG2aκ

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... RBM14(10432)

Immunogène

RBM14 (AAH00488, 51 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AIEALHGHELRPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQ

Forme physique

Clear solution

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

11 - Combustible Solids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Kenya Kobayashi et al.
ORL; journal for oto-rhino-laryngology and its related specialties, 76(3), 137-146 (2014-07-06)
Head and neck squamous cell carcinoma of an unknown primary site (HNSCCUP) is a heterogeneous group of tumors that includes the human papillomavirus (HPV)-associated oropharyngeal squamous cell carcinoma. To investigate the relationship between HNSCCUP and HPV, we reviewed p16 overexpression
Lanea M Keller et al.
Head & neck, 36(12), 1677-1684 (2013-10-12)
The purpose of this study was to report associations between p16 status, clinicopathologic characteristics, and outcomes for head and neck squamous cell carcinoma of unknown primary (CUP). Specimens of squamous cell CUP were reanalyzed. Human papillomavirus (HPV) status was determined
Patrick J Cimino et al.
Experimental and molecular pathology, 96(3), 310-315 (2014-04-08)
Viral pathogens have been implicated in the development of certain cancers including human papillomavirus (HPV) in squamous cell carcinoma and Epstein-Barr virus (EBV) in Burkitt's lymphoma. The significance of viral pathogens in brain tumors is controversial, and human cytomegalovirus (HCMV)
Fangli Cao et al.
International journal of clinical and experimental medicine, 7(10), 3430-3438 (2014-11-25)
The prognostic value of the HPV status in ESCC is much controversial, this study aimed to determine the prognostic importance of high-risk HPV and p16 in patients with ESCC. A total of 105 consecutive patients who underwent esophagectomy in 2008
Thomas Knösel et al.
Journal of clinical pathology, 67(7), 592-598 (2014-04-22)
p16(INK4a) is an important factor in carcinogenesis, and its expression is linked to oncogene-induced senescence. Very recently it was shown that upregulation and downregulation of p16 indicates a senescence barrier in the serrated route of colorectal cancer. However, in soft

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique