Accéder au contenu
MilliporeSigma
Toutes les photos(2)

Principaux documents

SAB1403512

Sigma-Aldrich

Monoclonal Anti-MUC5B antibody produced in mouse

clone 8C11, ascites fluid

Synonyme(s) :

MG1, MUC5, MUC9

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

ascites fluid

Type de produit anticorps

primary antibodies

Clone

8C11, monoclonal

Poids mol.

antigen ~38.21 kDa

Espèces réactives

human

Technique(s)

indirect ELISA: suitable
western blot: 1:500-1:1000

Isotype

IgG2aκ

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... MUC5B(727897)

Catégories apparentées

Description générale

Mucin 5B (MUC5B) is a high molecular mass, heavily O-glycosylated gel-forming mucin. It is encoded by the gene mapped to human chromosome 11p15.5. MUC5B is found in bronchus glands, submaxillary glands, endocervix, gall bladder, and pancreas.

Immunogène

MUC5B (XP_039877.9, 4186 a.a. ~ 4295 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
CEEDSCQVRINTTILWHQGCETEVNITFCEGSCPGASKYSAEAQAMQHQCTCCQERRVHEETVPLHCPNGSAILHTYTHVDECGCTPFCVPAPMAPPHTRGFPAQEATAV

Application

Monoclonal Anti-MUC5B antibody produced in mouse has been used in immunofluorescence .

Actions biochimiques/physiologiques

MUC5B is salivary mucin that might contribute to the lubrication, hydration, pathogen exclusion, and viscoelastic properties of the whole saliva. The protein acts as a marker of mucous gland cells. Mouse MUC5B plays a vital role in maintaining immune homeostasis in the lungs. It is also involved in preventing infections in the airways and middle ear by facilitating mucociliary clearance (MCC). Mutation in the MUC5B gene leads to the development of idiopathic pulmonary fibrosis. Overexpression of the gene stimulates aggressive behavior of breast cancer MCF7 cells.

Forme physique

Clear solution

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

11 - Combustible Solids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Hélène Valque et al.
PloS one, 7(10), e46699-e46699 (2012-10-12)
The mucin MUC5B has a critical protective function in the normal lung, salivary glands, esophagus, and gallbladder, and has been reported to be aberrantly expressed in breast cancer, the second leading cause of cancer-related deaths among women worldwide. To understand
Shinji Sumiyoshi et al.
Lung cancer (Amsterdam, Netherlands), 84(3), 281-288 (2014-04-15)
The characteristics of non-terminal respiratory unit (TRU) type lung adenocarcinoma are still unclear. The aim of the present study was to characterize non-TRU type lung adenocarcinoma. We analyzed the expression of mucins MUC5B and MUC5AC, as well as thyroid transcription
Grant E Duclos et al.
Science advances, 5(12), eaaw3413-eaaw3413 (2019-12-18)
The human bronchial epithelium is composed of multiple distinct cell types that cooperate to defend against environmental insults. While studies have shown that smoking alters bronchial epithelial function and morphology, its precise effects on specific cell types and overall tissue
Lina M Salazar-Peláez et al.
PloS one, 10(3), e0119717-e0119717 (2015-03-15)
Vitronectin, a multifunctional glycoprotein, is involved in coagulation, inhibition of the formation of the membrane attack complex (MAC), cell adhesion and migration, wound healing, and tissue remodeling. The primary cellular source of vitronectin is hepatocytes; it is not known whether
Heather S Davies et al.
PloS one, 9(9), e108372-e108372 (2014-09-30)
The salivary mucins that include MUC5B (gel-forming) and MUC7 (non-gel-forming) are major contributors to the protective mucus barrier in the oral cavity, and it is possible that dietary components may influence barrier properties. We show how one dietary compound, the

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique