Accéder au contenu
MilliporeSigma
Toutes les photos(3)

Principaux documents

SAB1402692

Sigma-Aldrich

Monoclonal Anti-APOC3, (C-terminal) antibody produced in mouse

clone 8H7, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

APOCIII, MGC150353

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

8H7, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~34.8 kDa

Espèces réactives

human

Technique(s)

immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... APOC3(345)

Catégories apparentées

Description générale

Apolipoprotein C3 (APOC3) is a 79 amino acid protein with a molecular weight of 8.8kDa. It is present on high density, low density and triglyceride-rich lipoproteins. The gene encoding this protein is localized on human chromosome 11q23.3.

Immunogène

APOC3 (NP_000031.1, 21 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA

Actions biochimiques/physiologiques

Apolipoprotein C3 (APOC3) is involved in the metabolism of triglyceride-rich lipoproteins. It may have a role in atherosclerosis. The protein stimulates hypertriglyceridemia (HTG) by inhibiting the activity of lipoprotein lipase and interfering with the binding of APOB or APOE to hepatic receptors. It also promotes very low density lipoprotein (VLDL) assembly and secretion in the liver.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Variants in the APOC3 promoter insulin responsive element modulate insulin secretion and lipids in middle-aged men
D. M> Waterworth
Biochim. Biophys. Acta Gen. Subj. (2003)
The emerging role of apolipoprotein C-III: beyond effects on triglyceride metabolism.
Luo M and Peng D
Liposome Technology (2016)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique