SAB1402487

Monoclonal Anti-RNF40 antibody produced in mouse

clone 1C1, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : BRE1B, DKFZp686K191, KIAA0661, MGC13051, RBP95, STARING
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 1C1, monoclonal
• Forme: buffered aqueous solution
• Poids mol.: antigen ~37 kDa
• Espèces réactives: human
• Technique(s): capture ELISA: suitable; immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotype: IgG2aκ
• Numéro d'accès NCBI: NM_014771
• Numéro d'accès UniProt: O75150
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... RNF40(9810)

Description

Description générale

The protein encoded by this gene contains a RING finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein was reported to interact with the tumor suppressor protein RB1. Studies of the rat counterpart suggested that this protein may function as an E3 ubiquitin-protein ligase, and facilitate the ubiquitination and degradation of syntaxin 1, which is an essential component of the neurotransmitter release machinery. (provided by RefSeq)

Immunogène

RNF40 (NP_055586, 102 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DETVEALLRCHESQGELSSAPEAPGTQEGPTCDGTPLPEPGTSELRDPLLMQLRPPLSEPALAFVVALGASSSEEVELELQGRMEFSKAAVSRVVEASD

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable