Accéder au contenu
MilliporeSigma
Toutes les photos(2)

Principaux documents

SAB1402212

Sigma-Aldrich

Monoclonal Anti-GNRH1, (C-terminal) antibody produced in mouse

clone 4H3, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

GNRH, GRH, LHRH, LNRH

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

4H3, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~33.7 kDa

Espèces réactives

human

Technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... GNRH1(2796)

Immunogène

GNRH1 (NP_000816, 24 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI

Actions biochimiques/physiologiques

GNRH (gonadotropin releasing hormone 1) controls the production of follicle-stimulating hormone and luteinizing hormone from pituitary gland. Mutation in the gene is associated with idiopathic hypogonadotropic hypogonadism.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

11 - Combustible Solids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Jérôme Bouligand et al.
The New England journal of medicine, 360(26), 2742-2748 (2009-06-19)
We investigated whether mutations in the gene encoding gonadotropin-releasing hormone 1 (GNRH1) might be responsible for idiopathic hypogonadotropic hypogonadism (IHH) in humans. We identified a homozygous GNRH1 frameshift mutation, an insertion of an adenine at nucleotide position 18 (c.18-19insA), in
Estee Stern et al.
The Journal of biological chemistry, 292(23), 9815-9829 (2017-04-08)
Neuroendocrine control of reproduction by brain-secreted pulses of gonadotropin-releasing hormone (GnRH) represents a longstanding puzzle about extracellular signal decoding mechanisms. GnRH regulates the pituitary gonadotropin's follicle-stimulating hormone (FSH) and luteinizing hormone (LH), both of which are heterodimers specified by unique
Isolated familial hypogonadotropic hypogonadism and a GNRH1 mutation.
Bouligand J
The New England Journal of Medicine, 360(26), 2742-2748 (2009)
GNRH1 mutations in patients with idiopathic hypogonadotropic hypogonadism.
Chan YM
Proceedings of the National Academy of Sciences of the USA, 106(28), 11703-11708 (2009)
Modeling and high-throughput experimental data uncover the mechanisms underlying Fshb gene sensitivity to gonadotropin-releasing hormone pulse frequency.
Stern E
The Journal of Biological Chemistry, 292(23), 9815-9829 (2017)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique