MSST0006

SILu^™Lite VEGFA Vascular endothelial growth factor A human

recombinant, expressed in HEK 293 cells, MS Protein Standard

• Synonyme(s) : SILuLite Vascular endothelial growth factor A
• Code UNSPSC : 23201100
• Nomenclature NACRES : NA.12

Propriétés

• Source biologique: human
• Niveau de qualité: 200
• Produit recombinant: expressed in HEK 293 cells
• Pureté: ≥98% (SDS-PAGE)
• Forme: lyophilized powder
• Technique(s): mass spectrometry (MS): suitable
• Numéro d'accès UniProt: P15692
• Température de stockage: −20°C
• Informations sur le gène: human ... VEGFA(7422)

Description

Description générale

SILu^™ Lite VEGF165 is a recombinant glycosylated human protein expressed in human 293 cells. It is a homodimer with an apparent molecular mass of 45 kDa.


Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)

Actions biochimiques/physiologiques

VEGF165 belongs to the PDGF/VEGF growth factor family characterized by the presence of eight conserved cysteine residues and a cystine knot structure.¹ VEGF is secreted by the majority of tumor cells and initiates angiogenesis by activating endothelial cells of existing blood vessels and promoting their migration.²
VEGF has also been implicated in correlation with poor prognosis in breast cancer.² In addition, VEGF is released in rheumatoid arthritis in response to TNF-α, increasing endothelial permeability and stimulating angiogenesis (formation of capillaries)^3,4

Séquence

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGC

Forme physique

Supplied as a lyophilized powder containing phosphate buffered saline

Informations légales

SILu is a trademark of Sigma-Aldrich Co. LLC

Informations sur la sécurité

• Code de la classe de stockage: 11 - Combustible Solids
• Classe de danger pour l'eau (WGK): WGK 2
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable