HPA041309
Anti-BICD1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonyme(s) :
Anti-Bicaudal d homolog 1 (Drosophila)
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Source biologique
rabbit
Conjugué
unconjugated
Forme d'anticorps
affinity isolated antibody
Type de produit anticorps
primary antibodies
Clone
polyclonal
Gamme de produits
Prestige Antibodies® Powered by Atlas Antibodies
Forme
buffered aqueous glycerol solution
Espèces réactives
human
Technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200
Séquence immunogène
YRQSRVTRSGSLKGPDDPRGLLSPRLARRGVSSPVETRTSSEPVAKESTEASKEPSPTKTPTISPVITAPPSSPVLDTSDIRKE
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... BICD1(636)
Description générale
The gene BICD1 (BICD cargo adaptor 1) is mapped to human chromosome 12p11. It is a coiled-coil protein.
BICD1 protein interacts with:
BICD1 protein interacts with:
- RAB6A (anti-RAB6A HPA059131)
- STAT3 (anti-STAT3 HPA001671)
- MAPK14 (anti-MAPK14 SAB4300499)
Immunogène
bicaudal D homolog 1 (Drosophila) recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-BICD1 antibody produced in rabbit has been used in western blotting and immunofluorescence.
Anti-BICD1 antibody produced in rabbit has been used in western blotting and immunofluorescence.
Actions biochimiques/physiologiques
BICD1 (BICD cargo adaptor 1) is needed for transport of mRNA transcripts and retrograde trafficking of vesicles from the Golgi to the endoplasmic reticulum. It interacts with Rab6B (Ras-related protein) to control retrograde transport of cargo in neuronal cells. It plays an important role in dynein function by forming a complex with dynein–dynactin. Dynein is needed for mitosis, nuclear migration, mRNA movements and axonal and dendritic vesicles transport. BICD1 also controls PAR1 (protease-activated receptor 1)-G protein signaling and endocytosis. PAR1 is a G protein-associated receptor which has important roles in cancer, angiogenesis, inflammation and thrombosis. BICD1 polymorphism rs2630778 is associated with telomere shortening. In addition, it is one of the susceptibility gene for emphysema.
Caractéristiques et avantages
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Liaison
Corresponding Antigen APREST81102
Forme physique
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Informations légales
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 1
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
A novel protease-activated receptor-1 interactor, Bicaudal D1, regulates G protein signaling and internalization.
Swift S, et al.
The Journal of Biological Chemistry, 285, 11402-11410 (2010)
Genetics of COPD.
Nakamura H, et al.
Allergology International, 60.3, 253-258 (2011)
Liujin Hou et al.
Frontiers in genetics, 13, 979001-979001 (2022-10-11)
Background: Colon cancer is the fifth most common cause of cancer-related death worldwide, and despite significant advances in related treatment, the prognosis of colon cancer patients remains poor. Objective: This study performs systematic bioinformatics analysis of prognostic-associated RNA processing factor
hTERT, BICD1 and chromosome 18 polymorphisms associated with telomere length affect kidney allograft function after transplantation.
Kloda K, et al.
Kidney & Blood Pressure Research, 40, 111-120 (2015)
The Rab6 GTPase regulates recruitment of the dynactin complex to Golgi membranes.
Short B, et al.
Current Biology, 12, 1792-1792 (2002)
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique