Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Principaux documents

HPA039200

Sigma-Aldrich

Anti-ESYT3 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-Chr3syt, Anti-Extended synaptotagmin-like protein 3, Anti-Fam62c

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Technique(s)

immunohistochemistry: 1:50- 1:200

Séquence immunogène

PYADLTLEQRFQLDHSGLDSLISMRLVLRFLQVEERELGSPYTGPEALKKGPLLIKKVATNQGPKAQPQEEGPTDLPCPPDPASDTKD

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... ESYT3(83850)

Description générale

Extended synaptotagmin 3 (ESYT3) is encoded by the gene mapped to human chromosome 3q22.3. The encoded protein belongs to the family of evolutionarily conserved mammalian proteins, referred to as E-Syts. ESYT3 is localized to the plasma membrane (PM) and is characterized by an N-terminal transmembrane region, a conserved central juxtamembranous domain and three C-terminal C (2) domains.

Immunogène

extended synaptotagmin-like protein 3 recombinant protein epitope signature tag (PrEST)

Application

Anti-ESYT3 antibody produced in rabbit has been used in immunoprecipitation assay.

Actions biochimiques/physiologiques

Extended synaptotagmin 3 (ESYT3) plays a vital role under hypoxia conditions. Mutation in the gene contributes to the pathogenesis of coronary artery disease in humans.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST79649

Forme physique

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

PI(4,5)P(2)-dependent and Ca(2+)-regulated ER-PM interactions mediated by the extended synaptotagmins.
Giordano F
Cell, 153, 1494-1509 (2013)
Population Variation Revealed High-Altitude Adaptation of Tibetan Mastiffs
Li Y
Molecular Biology and Evolution, 31, 1200-1205 (2014)
Fine mapping of chromosome 3q22.3 identifies two haplotype blocks in ESYT3 associated with coronary artery disease in female Han Chinese.
Jiang F
Atherosclerosis, 218, 397-403 (2011)
E-Syts, a family of membranous Ca2+-sensor proteins with multiple C2 domains.
Min SW
Proceedings of the National Academy of Sciences of the USA, 104, 3823-3828 (2007)
Rubén Fernández-Busnadiego et al.
Proceedings of the National Academy of Sciences of the United States of America, 112(16), E2004-E2013 (2015-03-20)
The close apposition between the endoplasmic reticulum (ER) and the plasma membrane (PM) plays important roles in Ca(2+) homeostasis, signaling, and lipid metabolism. The extended synaptotagmins (E-Syts; tricalbins in yeast) are ER-anchored proteins that mediate the tethering of the ER

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique