HPA036070
Anti-PTK6 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonyme(s) :
Anti-BRK, Anti-PTK6 protein tyrosine kinase 6
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Produits recommandés
Source biologique
rabbit
Conjugué
unconjugated
Forme d'anticorps
affinity isolated antibody
Type de produit anticorps
primary antibodies
Clone
polyclonal
Gamme de produits
Prestige Antibodies® Powered by Atlas Antibodies
Forme
buffered aqueous glycerol solution
Espèces réactives
human
Validation améliorée
recombinant expression
Learn more about Antibody Enhanced Validation
Technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200
Séquence immunogène
PYPGMSNHEAFLRVDAGYRMPCPLECPPSVHKLMLTCWCRDPEQRPCFKALRERLSSFTSYENPT
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... PTK6(5753)
Description générale
PTK6 (protein tyrosine kinase 6) belongs to intracellular tyrosine kinases family. It is normally expressed in epithelial cells of skin, gastrointestinal tract and prostate. It is also called as breast tumor kinase (brk), for its critical role in progression of breast cancer. The PTK6 gene is located on the human chromosome 20q13.33. PTK6 protein is expressed in two isoforms.
Immunogène
PTK6 protein tyrosine kinase 6 recombinant protein epitope signature tag (PrEST)
Application
Anti-PTK6 rabbit polyclonal antibody has been used in microarray analysis of PTK6 in breast tumor samples. It may also be used to detect protein tyrosine kinase 6 using western blot analysis in esophageal squamous cell carcinoma.
Actions biochimiques/physiologiques
Protein tyrosine kinase 6 regulates epithelial cell gene expression by modulating RNA binding proteins. It favours epidermal growth factor receptor signalling cascade. Mutations in kinase domain leads to activity suppression. PTK6 is effectively inhibited by tumor suppressor protein phosphatase and tensin homolog (PTEN) in human prostate cancer tissues and cell lines. PTK6 is highly expressed and up-regulated in a multitude of human carcinomas including hepatocellular carcinoma, cervical squamous carcinoma, prostate cancer and colon cancer. PTK6 mediates proteasome-mediated degradation of tumor suppressor protein by phosphorylation. With the advent of its association in human cancer, PTK6 is considered as a potential drug target for cancer chemotherapy.
Caractéristiques et avantages
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Liaison
Corresponding Antigen APREST78020
Forme physique
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Informations légales
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 1
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Koichi Ito et al.
Cancer research, 76(15), 4406-4417 (2016-06-16)
Patients with triple-negative breast cancers (TNBC) are at high risk for recurrent or metastatic disease despite standard treatment, underscoring the need for novel therapeutic targets and strategies. Here we report that protein tyrosine kinase 6 (PTK6) is expressed in approximately
PTK6 promotes hepatocellular carcinoma cell proliferation and invasion
Chen X, et al.
American Journal of Translational Research, 8(10), 4354-4354 (2016)
Protein tyrosine kinase 6 negatively regulates growth and promotes enterocyte differentiation in the small intestine
Haegebarth A, et al.
Molecular and Cellular Biology, 26(13), 4949-4957 (2006)
PTK6 inhibition suppresses metastases of triple-negative breast cancer via SNAIL-dependent E-cadherin regulation
Ito K, et al.
Cancer Research, 76(15), 4406-4417 (2016)
Breast tumor kinase (Brk/PTK6) is a mediator of hypoxia-associated breast cancer progression.
Anderson TMR, et al.
Cancer Research, 9(8), canres-ca0523 (2013)
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique