Accéder au contenu
MilliporeSigma
Toutes les photos(6)

Key Documents

HPA026816

Sigma-Aldrich

Anti-SEC11C antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-SEC11 homolog C (S. cerevisiae), Anti-SEC11L3, Anti-SPC21, Anti-SPCS4C

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Validation améliorée

recombinant expression
Learn more about Antibody Enhanced Validation

Technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

Séquence immunogène

MVRAGAVGAHLPASGLDIFGDLKKMNKRQLYYQV

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SEC11C(90701)

Description générale

SEC11 homolog C (SEC11C), mapped to human chromosome 18, encodes signal peptidase complex subunit 21 (SPC21) protein. The encoded protein is characterized with two hydrophobic domains, one at amino terminal end between signal peptidase complex 18 (SPC 18) residues 17-57, which functions as a transmembrane anchor and other hydrophobic domain is mapped between SPC 18 residues 144 and 176.

Immunogène

SEC11 homolog C (S. cerevisiae) recombinant protein epitope signature tag (PrEST)

Application

Anti-SEC11C antibody has been used in western blotting.
Anti-SEC11C antibody produced in rabbit has been used in western blotting. All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Actions biochimiques/physiologiques

In gastric cancer, SPC18 (signal peptidase complex 18) protein, coded by SEC11C (SEC11 homolog C, signal peptidase complex subunit), helps in the development through TGF-α(transforming growth factor alpha)secretion. SPC proteins present in vitro may participate in the mechanism of signal peptide processing and protein translocation.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST70171

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

A CRISPR screen defines a signal peptide processing pathway required by flaviviruses.
Zhang R, et al.
Nature, 535(7610), 164-164 (2016)
Signal peptidase complex 18, encoded by SEC11A, contributes to progression via TGF-a secretion in gastric cancer.
Oue N
Oncogene, 33(30), 3918-3926 (2014)
Paco Hulpiau et al.
Cellular and molecular life sciences : CMLS, 73(5), 1103-1116 (2015-09-18)
Paracaspases and metacaspases are two families of caspase-like proteins identified in 2000. Up until now paracaspases were considered a single gene family with one known non-metazoan paracaspase in the slime mold Dictyostelium and a single animal paracaspase called MALT1. Human
Two subunits of the canine signal peptidase complex are homologous to yeast SEC11 protein.
Shelness GS, Blobel G
The Journal of Biological Chemistry, 265(16), 9512-9519 (1990)
Rong Zhang et al.
Nature, 535(7610), 164-168 (2016-07-08)
Flaviviruses infect hundreds of millions of people annually, and no antiviral therapy is available. We performed a genome-wide CRISPR/Cas9-based screen to identify host genes that, when edited, resulted in reduced flavivirus infection. Here, we validated nine human genes required for

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique