Accéder au contenu
MilliporeSigma
Toutes les photos(7)

Principaux documents

HPA015284

Sigma-Aldrich

Anti-HLTF antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-DNA-binding protein/plasminogen activator inhibitor 1 regulator, Anti-HIP, Anti-Helicase-like transcription factor, Anti-SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3, Anti-Sucrose nonfermenting protein 2-like 3

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human, mouse, rat

Validation améliorée

orthogonal RNAseq
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

Technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

Séquence immunogène

LKKHGFKLGPAPKTLGFNLESGWGSGRAGPSYSMPVHAAVQMTTEQLKTEFDKLFEDLKEDDKTHEMEPAEAIETPLLPHQKQALAWMVSRENSKELPPFWEQRNDLYYNTITNFSEKDRPENVHGGILADDMGLGK

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... HLTF(6596)

Description générale

HLTF (helicase-like transcription factor) is a seven DNA helicase domain containing member of the SWI/SNF (mating-type switching/sucrose non-fermenting) family. Studies in HeLa cells show six isoforms of this protein, with the full length protein having a molecular weight of 115kDa. The 95kDa form lacks the helicase domains, present at the C-terminal, which are involved in DNA repair. It is a human ortholog of yeast Rad5 protein. This protein contains a Rad5-like domain, and a SWI/SNF helicase domain. This domain contains a C2HC4 RING domain.

Immunogène

Helicase-like transcription factor recombinant protein epitope signature tag (PrEST)

Application

Anti-HLTF antibody is suitable for chromatin immunoprecipitation (ChIP). Anti-HLTF antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Actions biochimiques/physiologiques

HLTF (helicase-like transcription factor) interacts and binds with DNA to control transcription. It utilizes the energy of ATP hydrolysis for chromatin remodeling, which is basic to multiple cellular processes. It plays a role in post-replication DNA repair, where it functions as E3 ubiquitin ligase and uniquitinates proliferating cell nuclear antigen (PCNA). This protein, along with translesion synthesis polymerases, is recruited to chromatin by the tumor suppressor protein BRCA1 (breast cancer 1, early onset). In stalled damaged DNA replication, this protein repairs the gaps in the replication fork. HLTF is hypermethylated and inactivated in multiple cancers such as, esophageal, gastric, colorectal and uterine cancer. Its expression correlates with the progression of thyroid neoplasia. Thus, it has potential as a marker to differentiate benign from malignant thyroid tumors. In cervical cancer, it increases the DNA repair capacity, and thus, confers resistance to radiotherapy.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST73675

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Vanessa Arcolia et al.
BMC cancer, 14, 492-492 (2014-07-10)
The preoperative characterization of thyroid nodules is a challenge for the clinicians. Fine-needle aspiration (FNA) is the commonly used pre-operative technique for diagnosis of malignant thyroid tumor. However, many benign lesions, with indeterminate diagnosis following FNA, are referred to surgery.
Peter Burkovics et al.
Nucleic acids research, 42(3), 1711-1720 (2013-11-08)
Stalling of replication forks at unrepaired DNA lesions can result in discontinuities opposite the damage in the newly synthesized DNA strand. Translesion synthesis or facilitating the copy from the newly synthesized strand of the sister duplex by template switching can
SungHwan Cho et al.
Journal of cancer research and clinical oncology, 137(4), 629-637 (2010-06-11)
Helicase-like transcription factor (HLTF) is a member of the SWI/SNF (mating type switching/sucrose non-fermenting) family of ATPases/helicases and also has a RING-finger motif characteristic of ubiquitin ligase proteins. These features have led to suggestions that HLTF functions like yeast Rad5
Rebecca A Helmer et al.
PloS one, 8(6), e66799-e66799 (2013-07-05)
HLTF participates in transcription, chromatin remodeling, DNA damage repair, and tumor suppression. Aside from being expressed in mouse brain during embryonic and postnatal development, little is known about Hltf's functional importance. Splice variant quantification of wild-type neonatal (6-8 hour postpartum)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique