HPA011155

Anti-LAIR1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-CD305 antigen, Anti-LAIR-1, Anti-Leukocyte-associated immunoglobulin-like receptor 1 precursor, Anti-hLAIR1
• Numéro MDL: MFCD02263578
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA011155
• Nomenclature NACRES : NA.43

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Validation améliorée: recombinant expression; orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Technique(s): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:500-1:1000
• Séquence immunogène: HRQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKATVNGLPEKDRETDTSALAAGSSQEVTYAQLDHWALTQRTARAVSPQSTKPMAESITYAAVARH
• Numéro d'accès UniProt: Q6GTX8
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... LAIR1(3903)

Description

Description générale

Leukocyte-associated immunoglobulin-like receptor-1 (LAIR-1) is a transmembrane glycoprotein which is a part of the leukocyte receptor complex (LRC)-encoded family. In its cytoplasmic domain, it contains two immunoreceptor tyrosine-based inhibition motifs (ITIMs). It is widely expressed on immune cells such as B cells, T cells, natural killer (NK) cells, monocytes, dendritic cells and CD34⁺ hematopoietic progenitor cells. LAIR-1 gene maps to human chromosome 19q13.4, and codes for a type I transmembrane protein, consisting of 287 amino acids. It has one C2-type Ig-like domain in its exoplasmic region. This gene contains 10 exons, and alternative splicing gives rise to many isosforms such as, LAIR-1a, LAIR-1b, LAIR-1c and LAIR-1d.

Immunogène

Leukocyte-associated immunoglobulin-like receptor 1 precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Actions biochimiques/physiologiques

Leukocyte-associated immunoglobulin-like receptor-1 (LAIR-1) suppresses the cytotoxic activity of natural killer (NK) cells, and also inhibits the differentiation of blood precursor cells into dendritic cells. It interacts with CD3 and prevents the cytotoxicity of effector T-cells. It cross links with B-cells, and prevents B-cell receptor (BCR)-induced calcium mobilization, as well as inhibition of immunoglobulin (Ig) and cytokine production. It inhibits protein kinase B (PKB) activation and granulocyte-macrophage colony-stimulating factor (GM-CSF)-dependent proliferation of leukemia cells. It might be involved in the regulation of immune response by extracellular matrix (ECM), by interacting with collagen, which leads to suppression of immune response. In rheumatoid arthritis (RA) patients, LAIR-1 is expressed on macrophages of inflamed synovial tissue. It prevents osteoclastogenesis, which might be useful for designing therapy for RA. It is also involved in the proliferation and invasion of epithelial ovarian cancer cells.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST72187

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)