Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Key Documents

C8490

SAFC

CRG-2 from mouse

BioReagent, recombinant, expressed in E. coli, ≥97% (SDS-PAGE), lyophilized powder, suitable for cell culture

Synonyme(s) :

CXCL10, Cytokine Responsive Gene 2, IP-10

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Numéro MDL:
Code UNSPSC :
12352209
Nomenclature NACRES :
NA.75

Produit recombinant

expressed in E. coli

Niveau de qualité

Gamme de produits

BioReagent

Pureté

≥97% (SDS-PAGE)

Forme

lyophilized powder

Poids mol.

predicted mol wt ~8.8 kDa

Technique(s)

cell culture | mammalian: suitable

Impuretés

endotoxin, tested

Numéro d'accès UniProt

Température de stockage

−20°C

Informations sur le gène

mouse ... Cxcl10(15945)

Description générale

Recombinant Mouse CRG-2 is produced from a DNA sequence encoding the mature mouse CRG-2/IP-10 protein sequence (MIPLARTVRCNCHIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTI KNLMKAFSQKRSKRAP). The methionyl form of the E. coli-expressed mature CRG-2 contains 78 amino acid residues and has a predicted molecular mass of approximately 8.8 kDa.

Recombinant Mouse CRG-2 (IP-10, CXCL10) is a member of the chemokine ??subfamily that lacks the ELR domain. Mouse CRG-2 cDNA encodes a 98 amino acid residue precursor protein with a 21 amino acid residue signal peptide that is cleaved to form the 77 amino acid residue secreted mature protein. Mature mouse CRG-2 shares approximately 67% amino acid sequence identity with human IP-10.

Forme physique

Lyophilized from a 0.2 μm filtered solution in PBS, pH 7.4, containing 50 μg bovine serum albumin per 1 μg of cytokine

Remarque sur l'analyse

The biological activity is measured by its ability to chemoattract human lymphocytes cultured in the presence of IL-2 for 21 days, or mouse BaF/3 cells transfected with hCXCR-3.

Code de la classe de stockage

11 - Combustible Solids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, type N95 (US)


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

S Mahalingam et al.
Immunology and cell biology, 78(2), 156-160 (2000-04-13)
MuMig (monokine induced by gamma interferon) and Crg-2 (cytokine responsive gene) are chemokines of the CXC subfamily. They share activity as T and NK cell chemoattractants. Crg-2 has been shown to be inducible by IFN, TNF, IL-1 and LPS, whereas
Y Ohmori et al.
Biochemical and biophysical research communications, 168(3), 1261-1267 (1990-05-16)
Recently, we have isolated and characterized a set of cDNA clones which encode lipopolysaccharide-inducible proteins in murine peritoneal macrophages. Here, we report the sequence and identification of one of these cDNAs previously termed C7. Nucleotide sequence analysis revealed an open
P Vanguri et al.
The Journal of biological chemistry, 265(25), 15049-15057 (1990-09-05)
In order to identify novel proteins produced by activated macrophages, a cDNA library was made from cultures of the mouse macrophage-like cell line RAW 264.7 that had been treated with conditioned medium from mitogen-stimulated spleen cells, and the library was
Takanobu Utsumi et al.
The Journal of urology, 192(2), 567-574 (2014-02-13)
Renal cell carcinoma expresses CXCR3 but the function of CXCR3 in renal cell carcinoma has not been clarified. We explored the function of CXCR3 in renal cell carcinoma and investigated CXCR3 regulating factors. We obtained 56 clinical samples of clear cell
Yingping Hou et al.
The Journal of investigative dermatology, 135(12), 3060-3067 (2015-07-24)
Recessive dystrophic epidermolysis bullosa (RDEB) is an inherited disorder characterized by skin fragility, blistering, and multiple skin wounds with no currently approved or consistently effective treatment. It is due to mutations in the gene encoding type VII collagen (C7). Using

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique