Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Key Documents

AV53597

Sigma-Aldrich

Anti-INHA antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-Inhibin, α

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

40 kDa

Espèces réactives

bovine, goat, sheep, human, pig

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... INHA(3623)

Description générale

NHA (inhibin, alpha) gene encodes the alpha subunit of inhibins A and B protein complexes that belongs to TGF-beta family. It is localized in the syncytiotrophoblast and the intermediate trophoblast of the placenta and may play a role in the mechanism of labor. INHA is also known as Inhibin α. Activin and inhibin are two closely related protein complexes involved in follicle-stimulating hormone (FSH) synthesis. They are produced in the gonads, pituitary gland, placenta, corpus luteum and other organs.

Immunogène

Synthetic peptide directed towards the N terminal region of human INHA

Application

Anti-INHA antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Actions biochimiques/physiologiques

Inhibins facilitates the regulation of numerous cellular processes including cell proliferation, apoptosis, immune response and hormone secretion. Loss of expression of inhibinα results in high grade prostate cancer. Follicle-stimulating hormone (FSH) stimulates the secretion of inhibin from the granulosa cells of the ovarian follicles in the ovaries. In turn, inhibin suppresses FSH. Inhibin secretion is diminished by GHRH, and enhanced by insulin-like growth factor-1. Inhibin may involve competing with activin for binding to activin receptors and binding to inhibin-specific receptors. Activin, inhibin and follistatin participate as intraovarian regulatory molecules involved in follicular cell proliferation, differentiation, steroidogenesis, oocyte maturation and corpus luteum function.

Séquence

Synthetic peptide located within the following region: GLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEP

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

G M Lambert-Messerlian et al.
Molecular and cellular endocrinology, 225(1-2), 101-108 (2004-09-29)
To date, the only routine clinical application of inhibin or activin measurement in testing for fetal abnormalities has been the use of inhibin A in prenatal screening for trisomy 21 (Down syndrome). Second trimester maternal serum levels of inhibin A
Stefano Luisi et al.
Human reproduction update, 11(2), 123-135 (2004-12-25)
A great deal of new information has arisen in the recent years concerning inhibin physiology and clinical relevance in reproductive medicine. It is now recognized that the two inhibin isoforms, named inhibin A and inhibin B, are produced by the
P van Zonneveld et al.
Human reproduction (Oxford, England), 18(3), 495-501 (2003-03-05)
The cause of declining fertility with age, in women who still have regular menstrual cycles, is not clear. Follicle development, endometrial growth and hormonal patterns were evaluated in cycles of older women (aged 41-46 years; n = 26) who previously
Matías L Stangaferro et al.
Animal reproduction science, 148(3-4), 97-108 (2014-07-09)
Cystic ovarian disease (COD) is an important cause of infertility in dairy cattle. Although many researchers have focused their work on the endocrine changes related to this disease, evidence indicates that intraovarian components play an important role in follicular persistence.
A Kondi-Pafiti et al.
Clinical and experimental obstetrics & gynecology, 40(1), 109-112 (2013-06-04)
The aim of the study was to examine, by an immunohistochemical method, the distribution of Inhibin-A and -B, in placentas from normal and pathological gestations. Sixty-two specimens of placental tissue were examined: i) ten cases from early gestations, ii) 28

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique