Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Principaux documents

AV50815

Sigma-Aldrich

Anti-VGLL2 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-VGL2, Anti-VITO1, Anti-Vestigial like 2 (Drosophila)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

33 kDa

Espèces réactives

horse, rat, rabbit, dog, human, bovine, guinea pig

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... VGLL2(245806)

Catégories apparentées

Immunogène

Synthetic peptide directed towards the middle region of human VGLL2

Application

Anti-VGLL2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.

Actions biochimiques/physiologiques

Vestigial-like family member 2 (VGLL2) acts as a co-factor of transcriptional enhancer factor 1 (TEF-1) and regulates transcription during skeletal muscle development. Members of VGLL family are involved in embryonic patterning, determination of cell fate, neural crest cell survival and craniofacial development in zebrafish.

Séquence

Synthetic peptide located within the following region: RPPEAEYINSRCVLFTYFQGDISSVVDEHFSRALSQPSSYSPSCTSSKAP

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Christopher W Johnson et al.
Developmental biology, 357(1), 269-281 (2011-07-12)
Invertebrate and vertebrate vestigial (vg) and vestigial-like (VGLL) genes are involved in embryonic patterning and cell fate determination. These genes encode cofactors that interact with members of the Scalloped/TEAD family of transcription factors and modulate their activity. We have previously
Corinne Faucheux et al.
The International journal of developmental biology, 54(8-9), 1375-1382 (2010-08-17)
The Drosophila Vestigial and Scalloped proteins form heterodimers that control wing development and are involved in muscle differentiation. Four vestigial like genes have been described in mammals. Similar to the Drosophila vestigial gene, they encode a short conserved domain (TONDU)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique