AV48521

Anti-FNTA antibody produced in rabbit

IgG fraction of antiserum

• Synonyme(s) : Anti-FPTA, Anti-Farnesyltransferase, CAAX box, α, Anti-MGC99680, Anti-PGGT1A
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: IgG fraction of antiserum
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 36 kDa
• Espèces réactives: human, rabbit
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès NCBI: NP_002018
• Numéro d'accès UniProt: A6NJW0
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Informations sur le gène: human ... FNTA(2339)

Description

Description générale

Farnesyltransferase, CAAX box, α (FNTA) forms a part of the heterodimeric CAAX farnesyltransferase complex that attaches a farnesyl moiety to a cysteine residue in proteins. The protein substrates usually comprise of nuclear lamins, retinal proteins and ras proteins.
Rabbit Anti-FNTA antibody recognizes canine, rat, human, and bovine FNTA.

Immunogène

Synthetic peptide directed towards the C terminal region of human FNTA

Application

Rabbit Anti-FNTA antibody is suitable for western blot applications at a concentration of 1.25 μg/ml.

Actions biochimiques/physiologiques

Prenyltransferases attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of protein′s with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share the same alpha subunit but have different beta subunits. FNTA is the alpha subunit of these transferases.Prenyltransferases attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of protein′s with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share the same alpha subunit but have different beta subunits. This gene encodes the alpha subunit of these transferases. Alternative splicing results in multiple transcript variants encoding different isoforms.

Séquence

Synthetic peptide located within the following region: DNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNV

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable