Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Key Documents

AV46745

Sigma-Aldrich

Anti-CORIN antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-ATC2, Anti-CRN, Anti-Lrp4, Anti-MGC119742, Anti-TMPRSS10

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

74 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_006578

Numéro d'accès UniProt

Q9Y5Q5

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... CORIN(10699)

Immunogène

Synthetic peptide directed towards the C terminal region of human CORIN

Application

Anti-CORIN antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/mL.

Actions biochimiques/physiologiques

CORIN gene encodes for a single-pass type II membrane protein. It is a transmembrane cardiac serine protease that plays a pivotal role in converting pro-atrial natriuretic peptide to biologically active atrial natriuretic peptide that regulates blood volume and pressure. In pregnant female, it stimulates the trophoblast invasion and spiral artery remodeling in uterus. Additionally, soluble corin facilitates as a potent biomarker for heart failure (HF).

Séquence

Synthetic peptide located within the following region: HPRYSRAVVDYDISIVELSEDISETGYVRPVCLPNPEQWLEPDTYCYITG

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Joshua R Huot et al.
American journal of cancer research, 11(6), 2990-3001 (2021-07-13)
Skeletal muscle wasting and weakness caused by cancer and its treatments (known as "cachexia") drastically impair quality of life and worsen survival outcomes in cancer patients. There are currently no approved treatments for cachexia. Hence, further investigation into the causes
Ningzheng Dong et al.
Clinica chimica acta; international journal of clinical chemistry, 413(3-4), 378-383 (2011-11-19)
Corin is a transmembrane serine protease identified in the heart, where it converts natriuretic peptides from inactive precursors to mature active forms. Studies in animal models and patients with hypertension and heart disease demonstrate that corin is critical in maintaining
W Yan et al.
Proceedings of the National Academy of Sciences of the United States of America, 97(15), 8525-8529 (2000-07-06)
Atrial natriuretic peptide (ANP) is a cardiac hormone essential for the regulation of blood pressure. In cardiac myocytes, ANP is synthesized as a precursor, pro-ANP, that is converted to biologically active ANP by an unknown membrane-associated protease. Recently, we cloned
Yujie Cui et al.
Nature, 484(7393), 246-250 (2012-03-23)
In pregnancy, trophoblast invasion and uterine spiral artery remodelling are important for lowering maternal vascular resistance and increasing uteroplacental blood flow. Impaired spiral artery remodelling has been implicated in pre-eclampsia, a major complication of pregnancy, for a long time but

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique