Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Principaux documents

AV46706

Sigma-Aldrich

Anti-ST3GAL3 (AB1) antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-SIAT6, Anti-ST3 β-galactoside α-2,3-sialyltransferase 3, Anti-ST3GALII, Anti-ST3GalIII, Anti-ST3N

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

42 kDa

Espèces réactives

mouse, guinea pig, rabbit, horse, rat, bovine, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... ST3GAL3(6487)

Description générale

ST3 β-galactoside α-2,3-sialyltransferase 3 (ST3GAL3,ST3GalIII, SIAT6) is a sialic acid transferring type II membrane protein found primarily in the Gogi apparatus; wherein sialic acid is transferred from CMP-sialic acid to galactose residues. ST3GAL3 forms the sialyl Lewis epitope on proteins. Defects in ST3GAL3 are associated with cognitive dysfunction.

Spécificité

Anti-ST3GAL3 (AB1) polyclonal antibody reacts with chicken, pig, bovine, canine, human, mouse, and rat β-galactoside α-2,3-sialyltransferase 3 proteins.

Immunogène

Synthetic peptide directed towards the N terminal region of human ST3GAL3

Application

Anti-ST3GAL3 (AB1) polyclonal antibody is used to tag β-galactoside α-2,3-sialyltransferase 3 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of β-galactoside α-2,3-sialyltransferase 3 in sialylation of glycoproteins in the Golgi apparatus.

Actions biochimiques/physiologiques

ST3GAL3 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. ST3GAL3 is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29.The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29. Multiple transcript variants encoding several different isoforms have been found for this gene.

Séquence

Synthetic peptide located within the following region: MTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTK

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Rossella Indellicato et al.
Glycobiology, 30(2), 95-104 (2019-10-05)
Three missense variants of ST3GAL3 are known to be responsible for a congenital disorder of glycosylation determining a neurodevelopmental disorder (intellectual disability/epileptic encephalopathy). Here we report a novel nonsense variant, p.Y220*, in two dichorionic infant twins presenting a picture of
Hao Hu et al.
American journal of human genetics, 89(3), 407-414 (2011-09-13)
The genetic variants leading to impairment of intellectual performance are highly diverse and are still poorly understood. ST3GAL3 encodes the Golgi enzyme β-galactoside-α2,3-sialyltransferase-III that in humans predominantly forms the sialyl Lewis a epitope on proteins. ST3GAL3 resides on chromosome 1

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique