Accéder au contenu
MilliporeSigma
Toutes les photos(2)

Key Documents

AV46329

Sigma-Aldrich

Anti-XTP3TPA (AB1) antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-CDA03, Anti-MGC5627, Anti-RS21C6, Anti-XTP3-transactivated protein A

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

19 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

NP_077001

Numéro d'accès UniProt

Q9H773

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... XTP3TPA(79077)

Immunogène

Synthetic peptide directed towards the middle region of human XTP3TPA

Application

Anti-XTP3TPA (AB1) antibody produced in rabbit has been used for western blotting at a concentration of 0.5μg/ml. It has also been used for immunohistochemistry at a concentration of 4-8μg/ml.

Actions biochimiques/physiologiques

XTP3TPA (XTP3-transactivated protein A) also referred as DCTPP1 or RS21C6 is a 170 amino acid protein expressed in embryonic and highly proliferating cells primarily in liver, kidney, ovary and testis with particularly high expression in cancer cells.DCTPP1 hydrolyses 5-formyl-dCTP and plays a crucial role in the balance of dCTP as well as facilitates the metabolism of deoxycytidine analogs; hence contribute to the preservation of genome integrity.

Séquence

Synthetic peptide located within the following region: KMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Cristina E Requena et al.
The Biochemical journal, 459(1), 171-180 (2014-01-29)
The size and composition of dNTP (deoxyribonucleoside triphosphate) pools influence the accuracy of DNA synthesis and consequently the genetic stability of nuclear and mitochondrial genomes. In order to keep the dNTP pool in balance, the synthesis and degradation of DNA
Beili Wu et al.
Journal of molecular biology, 367(5), 1405-1412 (2007-02-27)
RS21-C6, which is highly expressed in all vertebrate genomes and green plants, is proposed to have nucleoside triphosphate pyrophosphohydrolase activity. Here, we report the crystal structures of the core fragment of RS21-C6, named RSCUT, and the complex with the substrate

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique