AV46090

Anti-PEX3 antibody produced in rabbit

IgG fraction of antiserum

• Synonyme(s) : Anti-Peroxisomal biogenesis factor 3, Anti-TRG18
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: IgG fraction of antiserum
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 42 kDa
• Espèces réactives: horse, human, mouse, guinea pig, dog, rabbit, rat, bovine
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): immunohistochemistry: suitable; western blot: suitable
• Numéro d'accès NCBI: NP_003621
• Numéro d'accès UniProt: P56589
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... PEX3(8504)

Description

Description générale

Peroxisomal biogenesis factor 3 (PEX3, TRG18), a PEX19 docking protin, and PEX19 have key roles in the biogenesis of peroxisomes. Membrane-anchored PEX3 functions as a PEX19 receptor, wherein PEX19 recognizes newly synthesized peroxisomal membrane proteins (PMP) and recruits them to the peroxisomal membrane.

Spécificité

Anti-PEX3 polyclonal antibody reacts with bovine, human, mouse, rat, canine, zebrafish, and chicken peroxisomal biogenesis factor 3 proteins.

Immunogène

Synthetic peptide directed towards the N terminal region of human PEX3

Application

Anti-PEX3 polyclonal antibody is used to tag peroxisomal biogenesis factor 3 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of peroxisomal biogenesis factor 3 in peroxisome biosynthesis.

Actions biochimiques/physiologiques

PEX3 is involved in peroxisome biosynthesis and integrity. It assembles membrane vesicles before the matrix proteins are translocated. As a docking factor for PEX19, it is necessary for the import of peroxisomal membrane proteins in the peroxisomes.

Séquence

Synthetic peptide located within the following region: KYGQKKIREIQEREAAEYIAQARRQYHFESNQRTCNMTVLSMLPTLREAL

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable