Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Key Documents

AV46056

Sigma-Aldrich

Anti-EIF2S3 antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-EIF2, Anti-EIF2G, Anti-EIF2gamma, Anti-Eukaryotic translation initiation factor 2, subunit 3 γ, 52 kDa

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

51 kDa

Espèces réactives

human, dog, rat, bovine, rabbit, guinea pig, mouse, horse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_001406

Numéro d'accès UniProt

P41091

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... EIF2S3(1968)

Immunogène

Synthetic peptide directed towards the N terminal region of human EIF2S3

Application

Anti-EIF2S3 antibody produced in rabbit is suitable for western blotting at a concentration of 5μg/ml.

Actions biochimiques/physiologiques

EIF2S3 gene encodes a eukaryotic translation initiation factor 2, subunit 3 gamma protein of 52kDa. It is the core subunit of the heterotrimeric GTP-binding protein that facilitates the recruitment of methionyl-tRNA to the 40S ribosomal subunit.

Séquence

Synthetic peptide located within the following region: LDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDI

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Guntram Borck et al.
Molecular cell, 48(4), 641-646 (2012-10-16)
Together with GTP and initiator methionyl-tRNA, translation initiation factor eIF2 forms a ternary complex that binds the 40S ribosome and then scans an mRNA to select the AUG start codon for protein synthesis. Here, we show that a human X-chromosomal
M K Ray et al.
Biochemistry, 32(19), 5151-5159 (1993-05-18)
A eukaryotic initiation factor 2 (eIF-2) associated 67-kDa polypeptide (p67) protects the eIF-2 alpha-subunit from eIF-2 kinase(s) catalyzed phosphorylation, and this promotes protein synthesis in the presence of active eIF-2 kinase(s), [Datta, B., et al. (1988) Proc. Natl. Acad. Sci.

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique