AV44660

Anti-LRRC26 antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-bA350O14.10
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 37 kDa
• Espèces réactives: dog, human
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès NCBI: NP_001013675
• Numéro d'accès UniProt: Q2I0M4
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... LRRC26(389816)

Description

Description générale

Leucine-rich repeat (LRR)-containing protein 26 (LRRC26) functions as an auxiliary protein that complexes with and modulates the activation requirements of large-conductance, voltage- and calcium-activated potassium (BK, or K(Ca)1.1) and alkaline activated Slo channels. LRRC26 modulates the gating of a BK channel by enhancing the allosteric coupling between voltage-sensor activation and the channel′s closed-open transition.

Spécificité

Anti-LRRC26 polyclonal antibody reacts with canine and human leucine-rich repeat (LRR)-containing protein 26 proteins.

Immunogène

Synthetic peptide directed towards the middle region of human LRRC26

Application

Anti-LRRC26 polyclonal antibody is used to tag leucine-rich repeat (LRR)-containing protein 26 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of leucine-rich repeat (LRR)-containing protein 26 as a modulator of BK channel hyperpolarization activation and Slo3 channel alkalization activation.

Séquence

Synthetic peptide located within the following region: LRPLCAWLRRHPLPASEAETVLCVWPGRLTLSPLTAFSDAAFSHCAQPLA

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable