Accéder au contenu
MilliporeSigma
Toutes les photos(2)

Key Documents

AV44361

Sigma-Aldrich

Anti-POR (AB2) antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-CPR, Anti-CYPOR, Anti-DKFZp686G04235, Anti-FLJ26468, Anti-P450 (cytochrome) oxidoreductase, Anti-P450R

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

77 kDa

Espèces réactives

rat, rabbit, mouse, bovine, guinea pig, human, horse, dog

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... POR(5447)

Description générale

P450 (cytochrome) oxidoreductase (POR, CγPOR, P450R) is an FAD and FMN microsome membrane-bound enzyme required for electron transfer to several cytochrome P450 enzymes, heme oxygenase(s), cytochrome b(5) and squalene monooxygenases. CγPOR is an essential electron donor to enzymes involved in cholesterol biosynthesis. Mutation of CγPOR have been linked to Antley-Bixler-like Syndrome (ABS).

Spécificité

Anti-POR (AB2) polyclonal antibody reacts with bovine, human, mouse, rat, pig, canine, zebrafish, chicken, and rabbit P450 (cytochrome) oxidoreductases.

Immunogène

Synthetic peptide directed towards the N terminal region of human POR

Application

Anti-POR (AB2) polyclonal antibody is used to tag P450 (cytochrome) oxidoreductase for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of P450 (cytochrome) oxidoreductase in metabolic processes that depend upon electron transfer to P450 enzymes, heme oxygenases, cytochrom b5 and squalene monooxygenases.

Actions biochimiques/physiologiques

POR is an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this POR gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.This gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Séquence

Synthetic peptide located within the following region: IDNALVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKT

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Jin Wuk Lee et al.
Environmental toxicology, 29(9), 1032-1042 (2012-11-30)
Benzo(a)pyrene (BaP) is a polycyclic aromatic hydrocarbon that causes mutations and tumor formation. Zacco platypus is a sentinel species that is suitable for monitoring aquatic environments. We studied cytochrome P450 system (CYP system) expression and DNA adduct formation in the

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique