AV44268

Anti-TGFBI antibody produced in rabbit

IgG fraction of antiserum

• Synonyme(s) : Anti-BIGH3, Anti-CDB1, Anti-CDG2, Anti-CDGG1, Anti-CSD, Anti-CSD1, Anti-CSD2, Anti-Transforming growth factor, β-induced, 68 kDa
• Code UNSPSC : 12352203

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: IgG fraction of antiserum
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 46 kDa
• Espèces réactives: horse, human, guinea pig, mouse, bovine, rabbit
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): immunofluorescence: suitable; western blot: suitable
• Numéro d'accès NCBI: NP_000349
• Numéro d'accès UniProt: Q15582
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... TGFBI(7045)

Description

Description générale

Transforming growth factor, β-induced, 68 kDa (TGFB1, BIGH3, CDB1, CDG2, CDGG1, CSD) is a cell signaling protein with a wide range of functions, mostly as a negative/suppressive modulator of cell growth. TGFB1 is a modulator of immune function and an inducer of cell transformation. The actions of TGFB1 are mediated via transforming growth factor β receptors.

Spécificité

Anti-TGFBI polyclonal antibody reacts with chicken, human, mouse, rat, bovine, pig, and rabbit transforming growth factor, β 1 proteins.

Immunogène

Synthetic peptide directed towards the C terminal region of human TGFBI

Application

Anti-TGFBI polyclonal antibody is used to tag transforming growth factor, β 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of transforming growth factor, β 1 in cell signaling within a wide range of cell types.

Actions biochimiques/physiologiques

TGFBI Binds to type I, II, and IV collagens. This adhesion protein may play an important role in cell-collagen interactions. In cartilage, may be involved in endochondral bone formation.

Séquence

Synthetic peptide located within the following region: LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable