Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Documents

AV44247

Sigma-Aldrich

Anti-MICA antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-DAQB-48K1.7, Anti-MGC111087, Anti-MHC class I polypeptide-related sequence A, Anti-PERB11.1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

42 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_000238

Numéro d'accès UniProt

Q29983

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... MICA(4276)

Immunogène

Synthetic peptide directed towards the middle region of human MICA

Application

Anti-MICA antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

Actions biochimiques/physiologiques

MHC Class I polypeptide-related sequences A and B (MICA and MICB) are surface glycoproteins expressed constitutively on the enterocytes. They act as ligands for the natural killer group 2, member D (NKG2D) immunoreceptor activation. MICA binds NKG2D receptor and activates the CD8+T cells. Tissue damage or increased expression of MICA results in auto-antibodies detected in early-onset systemic lupus erythematosus and celiac disease.

Séquence

Synthetic peptide located within the following region: LRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDT

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

S Bahram et al.
Proceedings of the National Academy of Sciences of the United States of America, 91(14), 6259-6263 (1994-07-05)
Major histocompatibility complex (MHC) class I genes typically encode polymorphic peptide-binding chains which are ubiquitously expressed and mediate the recognition of intracellular antigens by cytotoxic T cells. They constitute diverse gene families in different species and include the numerous so-called
Antonio López-Vázquez et al.
BMC medicine, 12, 34-34 (2014-02-26)
Overexpression of autologous proteins can lead to the formation of autoantibodies and autoimmune diseases. MHC class I polypeptide-related sequence A (MICA) is highly expressed in the enterocytes of patients with celiac disease, which arises in response to gluten. The aim
Zhenpeng Dai et al.
The Journal of experimental medicine, 206(4), 793-805 (2009-03-18)
The NKG2D receptor stimulates natural killer cell and T cell responses upon engagement of ligands associated with malignancies and certain autoimmune diseases. However, conditions of persistent NKG2D ligand expression can lead to immunosuppression. In cancer patients, tumor expression and shedding
Natasja Nielsen et al.
Immunology, 142(4), 581-593 (2014-03-29)
Rheumatoid arthritis (RA) is an autoimmune disease characterized by chronic inflammation and synovial hyperplasia leading to progressive joint destruction. Fibroblast-like synoviocytes (FLS) are central components of the aggressive, tumour-like synovial structure termed pannus, which invades the joint space and cartilage.

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique