AV41491

Anti-GPX3 antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-GPx-P, Anti-GSHPx-3, Anti-GSHPx-P, Anti-Glutathione Peroxidase 3 (plasma)
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 25 kDa
• Espèces réactives: mouse, rat, human, bovine
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): immunohistochemistry: suitable; western blot: suitable
• Numéro d'accès NCBI: NP_002075
• Numéro d'accès UniProt: P22352
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... GPX3(2878)

Description

Description générale

Glutathione peroxidase refers to a family of isozymes that protect organisms from oxidative damage by reducing lipid hydroperoxides to their corresponding alcohols. Glutathione peroxidase 3 (GPX3) is an extracellular Gpx isozyme found mainly in plasma.

Spécificité

Anti-GPX3 polyclonal antibody reacts with human, mouse, rat, bovine, canine, and pig glutathione peroxidase 3 proteins.

Immunogène

Synthetic peptide directed towards the N terminal region of human GPX3

Application

Anti-GPX3 polyclonal antibody is used to tag glutathione peroxidase-3 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to study the antioxidant lipid protecting role of glutathione peroxidase 3 in extracellular space and plasma.

Actions biochimiques/physiologiques

GPX3 belongs to the glutathione peroxidase family, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination.Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme. GPX3 expression appears to be tissue-specific.

Séquence

Synthetic peptide located within the following region: DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable