AV40735

Anti-PRPF6 (AB2) antibody produced in rabbit

IgG fraction of antiserum

• Synonyme(s) : Anti-ANT-1, Anti-PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae), Anti-TOM
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: IgG fraction of antiserum
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 104 kDa
• Espèces réactives: dog, guinea pig, human, bovine, rabbit, mouse, rat, horse
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès NCBI: NP_036601
• Numéro d'accès UniProt: O94906
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... PRPF6(24148)

Description

Description générale

PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae) (PRPF6) is involved in pre-mRNA spliceosome assembly by acting as a link between small nuclear ribonucleoproteins (snRNP) U5 snRNP and U4/U6 snRNP to form U4/U6-U5 tri-snPNP. Mutation of PRPF6 are linked to impairment of pre-mRNA splicing and autosomal-dominant retinitis pigmentosa.

Spécificité

Anti-PRPF6 (AB2) polyclonal antibody reacts with bovine, human, mouse, rat, zebrafish, and canine PRP6 pre-mRNA processing factor 6 proteins.

Immunogène

Synthetic peptide directed towards the N terminal region of human PRPF6

Application

Anti-PRPF6 (AB2) polyclonal antibody is used to tag PRP6 pre-mRNA processing factor 6 homolog for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of PRP6 pre-mRNA processing factor 6 homolog in spliceosome assembly and autosomal-dominant retinitis pigmentosa.

Actions biochimiques/physiologiques

PRPF6 appears to be involved in pre-mRNA splicing, possibly acting as a bridging factor between U5 and U4/U6 snRNPs in formation of the spliceosome. PRPF6 also can bind androgen receptor, providing a link between transcriptional activation and splicing.The protein encoded by this gene appears to be involved in pre-mRNA splicing, possibly acting as a bridging factor between U5 and U4/U6 snRNPs in formation of the spliceosome. The encoded protein also can bind androgen receptor, providing a link between transcriptional activation and splicing.

Séquence

Synthetic peptide located within the following region: PGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEE

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable