AV40417

Anti-PSMA1 antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-HC2, Anti-MGC14542, Anti-MGC14575, Anti-MGC14751, Anti-MGC1667, Anti-MGC21459, Anti-MGC22853, Anti-Proteasome (prosome, macropain) subunit, α type, 1
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 29 kDa
• Espèces réactives: mouse, human, dog, rabbit, rat, horse, bovine, guinea pig
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): immunohistochemistry: suitable; western blot: suitable
• Numéro d'accès NCBI: NP_683877
• Numéro d'accès UniProt: P25786
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Informations sur le gène: human ... PSMA1(5682)

Description

Description générale

Proteasome (prosome, macropain) subunit, α type, 1 (PSMA1), a T1A family peptidase, is an α subunit of the complex 20S core structure of the proteosome, a multicatalytic proteinase complex.

Spécificité

Anti-PSMA1 polyclonal antibody reacts with bovine, human, mouse, rat, chicken, zebrafish, and canine proteasome (prosome, macropain) subunit, α type, 1 proteins.

Immunogène

Synthetic peptide directed towards the C terminal region of human PSMA1

Application

Anti-PSMA1 polyclonal antibody is used to tag pregnancy specific proteasome (prosome, macropain) subunit, α type, 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles proteasome (prosome, macropain) subunit, α type, 1 in proteasome structure and function.

Actions biochimiques/physiologiques

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA1 is a member of the peptidase T1A family which is a 20S core alpha subunit.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.

Séquence

Synthetic peptide located within the following region: TYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDL

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable