AV40248

Anti-SF3B1 (AB1) antibody produced in rabbit

IgG fraction of antiserum

• Synonyme(s) : Anti-Splicing factor 3b, subunit 1, 155 kDa
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: IgG fraction of antiserum
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 87 kDa
• Espèces réactives: guinea pig, dog, rat, human, bovine, rabbit, horse, mouse
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): immunohistochemistry: suitable; western blot: suitable
• Numéro d'accès NCBI: NP_036565
• Numéro d'accès UniProt: O75533
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... SF3B1(23451)

Description

Description générale

Splicing factor 3b, subunit 1, 155 kDa (SF3B1, SAP155, PRP10) is a subunit of the splicing factor 3b protein complex, which along with splicing factor 3a and 12S RNA forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). SF3B1 is also a component of the minor U12-type spliceosome. Mutations of SF3B1have been linked to myelodysplastic syndromes (MDS) and chronic lymphocytic leukemia (CLL).

Spécificité

Anti-SF3B1 (AB1) polyclonal antibody reacts with zebrafish, chicken, canine, human, mouse, and rat splicing factor 3b, subunit 1, 155 kDa proteins.

Immunogène

Synthetic peptide directed towards the middle region of human SF3B1

Application

Anti-SF3B1 (AB1) polyclonal antibody is used to tag splicing factor 3b, subunit 1, 155 kDa for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of splicing factor 3b, subunit 1, 155 kDa in U2-snRNP and U12-type spliceosome formation and function.

Actions biochimiques/physiologiques

SF3B1 is the subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron′s branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome.

Séquence

Synthetic peptide located within the following region: LLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADG

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable