Accéder au contenu
MilliporeSigma
Toutes les photos(2)

Key Documents

AV39341

Sigma-Aldrich

Anti-TRIM62 antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-Tripartite motif-containing 62

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

54 kDa

Espèces réactives

rat, pig, bovine, mouse, horse, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_060677

Numéro d'accès UniProt

Q9BVG3

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... TRIM62(55223)

Catégories apparentées

Description générale

Tripartite motif containing 62 (TRIM62) is a cytoplasmic protein that functions as a RING finger E3 ubiquitin ligase. It is known to catalyze self-ubiquination.
Rabbit Anti-TRIM62 antibody recognizes canine, human, mouse, rat, and bovine TRIM62.

Immunogène

Synthetic peptide directed towards the N terminal region of human TRIM62

Application

Rabbit Anti-TRIM62 antibody is suitable for western blot applications at a concentration of 1.25 μg/ml.

Actions biochimiques/physiologiques

TRIM62 contains 1 RING-type zinc finger, which is probably involved in mediating protein-protein interactions. RING-type zinc finger was identified in a group of proteins with a wide range of functions such as viral replication, signal transduction, and development. But the function of TRIM62 remains unknown.

Séquence

Synthetic peptide located within the following region: CSICLSIYQDPVSLGCEHYFCRRCITEHWVRQEAQGARDCPECRRTFAEP

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Fang Huang et al.
Biochemical and biophysical research communications, 432(2), 208-213 (2013-02-14)
TRIM62, also named DEAR1, is a member of the TRIM/RBCC family, which includes proteins with conserved RING finger, B-box and coiled-coil domains. Several reports have identified a role for this family in cancer, retroviral infection and innate immunity. In this

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique