AV35236

Anti-CACNG4 antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-Calcium channel, voltage-dependent, γ subunit 4, Anti-MGC11138, Anti-MGC24983
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 36 kDa
• Espèces réactives: human, rat, bovine, guinea pig, mouse, horse, rabbit
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès NCBI: NP_055220
• Numéro d'accès UniProt: Q9UBN1
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... CACNG4(27092)

Description

Description générale

CACNG4 is a type I transmembrane AMPA receptor regulatory protein (TARP). Studies have reported that targeted disruption in CACNG4 gene exaggerates spike-wave seizures in stargazer mouse.
Rabbit Anti-CACNG4 antibody recognizes chicken, zebrafish, bovine, human, mouse, and rat CACNG4.

Immunogène

Synthetic peptide directed towards the N terminal region of human CACNG4

Application

Rabbit Anti-CACNG4 antibody is suitable for western blot applications at a concentration of 1 μg/ml.

Actions biochimiques/physiologiques

L-type calcium channels are composed of five subunits. CACNG4 represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This gene is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family.L-type calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This gene is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two similar gamma subunit-encoding genes.L-type calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This gene is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two similar gamma subunit-encoding genes.

Séquence

Synthetic peptide located within the following region: GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYL

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 2
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable