APREST94161

PrEST Antigen TRHR

Prestige Antigens Powered by Atlas Antibodies

• Code UNSPSC : 12352203

Propriétés

• Produit recombinant: expressed in E. coli
• Pureté: >80% (SDS-PAGE)
• Forme: buffered aqueous solution
• Poids mol.: predicted mol wt 23 kDa
• Produit purifié par: immobilized metal affinity chromatography (IMAC)
• Concentration: ≥0.5 mg/mL
• Séquence immunogène: ILFLNPIPSDPKENSKTWKNDSTHQNTNLNVNTSNRCFNSTVSSRKQVTK
• Numéro d'accès Ensembl | humain: ENSG00000174417
• Numéro d'accès UniProt: P34981
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Informations sur le gène: human ... TRHR(7201)

Description

Description générale

Recombinant protein fragment of Human TRHR with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag

Application

Blocking agent and positive assay control using corresponding antibodies.

Forme physique

Solution in phosphate-buffered saline and 1M Urea, pH 7.4

Notes préparatoires

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 2
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable