Skip to Content
MilliporeSigma
All Photos(6)

Key Documents

WH0200576M1

Sigma-Aldrich

Monoclonal Anti-PIP5K3 antibody produced in mouse

clone 6C7, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-CFD, Anti-KIAA0981, Anti-MGC40423, Anti-PIKfyve, Anti-PIP5K, Anti-p235, Anti-phosphatidylinositol-3-phosphate/phosphatidylinositol 5-kinase, type III

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

6C7, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

ELISA: suitable
capture ELISA: suitable
immunofluorescence: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PIP5K3(200576)

General description

PIP5K3 belongs to a large family of lipid kinases that alter the phosphorylation status of intracellular phosphatidylinositol. Signaling by phosphorylated species of phosphatidylinositol regulates diverse cellular processes, including membrane trafficking and cytoskeletal reorganization (Shisheva et al., 1999 [PubMed 9858586]).[supplied by OMIM

Immunogen

PIP5K3 (NP_689884, 342 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQIAEEGDDNLANSASPSKRTSVSSFQSTVDSDSAASISLNVELDNVNFHIKKPSKYPHVPPHPADQKGRR

Biochem/physiol Actions

Phosphatidylinositol-3-phosphate/phosphatidylinositol-5-kinase, type III (PIP5K3) is involved in the synthesis of phosphatidylinositol 3, 5-bisphosphate. It also possesses a protein kinase activity. PIP5K3 regulates specific signaling pathways as well as membrane trafficking. Mutations in the gene encoding it are associated with fleck corneal dystrophy.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

nwg

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Andreas Kotoulas et al.
Molecular vision, 17, 2776-2781 (2011-11-09)
To report the findings of the clinical and molecular evaluation in a Greek family with fleck corneal dystrophy (CFD). A 58-year-old woman was seen on routine ophthalmic examination and diagnosed as having CFD. All available family members were examined to
Diego Sbrissa et al.
American journal of physiology. Cell physiology, 303(4), C436-C446 (2012-05-25)
PIKfyve is an essential mammalian lipid kinase with pleiotropic cellular functions whose genetic knockout in mice leads to preimplantation lethality. Despite several reports for PIKfyve-catalyzed synthesis of phosphatidylinositol 5-phosphate (PtdIns5P) along with phosphatidylinositol-3,5-biphosphate [PtdIns(3,5)P(2)] in vitro and in vivo, the

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service