Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

WH0153769M1

Sigma-Aldrich

Monoclonal Anti-SH3RF2 antibody produced in mouse

clone 4E10, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-FLJ23654, Anti-MGC90410, Anti-RNF158, Anti-SH3 domain containing ring finger 2

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

4E10, monoclonal

form

buffered aqueous solution

species reactivity

mouse, rat, human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SH3RF2(153769)

Immunogen

SH3RF2 (NP_660205, 640 a.a. ~ 729 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VKTVRFQNYSPPPTKHYTSHPTSGKPEQPATLKASQPEAASLGPEMTVLFAHRSGCHSGQQTDLRRKSALAKATTLVSTASGTQTVFPSK

Biochem/physiol Actions

SH3 domain containing ring finger 2 (SH3RF2) binds to protein phosphatase 1 in vitro. It is an anti-apoptotic protein which negatively regulates c-Jun N-terminal kinase (JNK) pathway and also associates with p21-activated kinase 4. SH3RF2 has been shown to be upregulated in cancers.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

nwg

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Chun-Yu Chen et al.
Biochemical and biophysical research communications, 391(1), 698-702 (2009-12-01)
In this report, we identified the novel protein heart protein phosphatase 1-binding protein (Hepp1), encoded by FLJ23654. Hepp1 associated with protein phosphatase 1 (PP1) by yeast two-hybrid, GST pull-down, co-immunoprecipitation, and far Western blotting assays. Northern blot analysis revealed that
Michael Wilhelm et al.
The Journal of biological chemistry, 287(3), 2247-2256 (2011-12-01)
We report that Sh3rf2, a homologue of the pro-apoptotic scaffold POSH (Plenty of SH3s), acts as an anti-apoptotic regulator for the c-Jun N-terminal kinase (JNK) pathway. siRNA-mediated knockdown of Sh3rf2 promotes apoptosis of neuronal PC12 cells, cultured cortical neurons, and
Tae Woo Kim et al.
Carcinogenesis, 35(3), 624-634 (2013-10-17)
SH3RF (SH3-domain-containing RING finger protein) family members, SH3RF1-3, are multidomain scaffold proteins involved in promoting cell survival and apoptosis. In this report, we show that SH3RF2 is an oncogene product that is overexpressed in human cancers and regulates p21-activated kinase

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service