WH0010120M5

Monoclonal Anti-ACTR1B antibody produced in mouse

clone 4E10, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-ARP1 actin-related protein 1 homolog B, centractin beta (yeast), Anti-ARP1B, Anti-CTRN2
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 4E10, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): immunofluorescence: suitable; indirect ELISA: suitable
• isotype: IgG2aκ
• GenBank accession no.: NM_005735
• UniProt accession no.: P42025
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ACTR1B(10120)

Description

General description

This gene encodes a 42.3 kD subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein and is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit, like ACTR1A, is an actin-related protein. These two proteins, which are of equal length and share 90% amino acid identity, are present in a constant ratio of approximately 1:15 in the dynactin complex. (provided by RefSeq)

Immunogen

ACTR1B (NP_005726, 191 a.a. ~ 286 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SRYLRLLLRKEGVDFHTSAEFEVVRTIKERACYLSINPQKDEALETEKVQYTLPDGSTLDVGPARFRAPELLFQPDLVGDESEGLHEVVAFAIHK*

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Safety Information

• Storage Class Code: 10 - Combustible liquids
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves