Skip to Content
MilliporeSigma
All Photos(7)

Key Documents

WH0008805M1

Sigma-Aldrich

Monoclonal Anti-TRIM24 antibody produced in mouse

clone 2F2, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-PTC6, Anti-RNF82, Anti-TF1A, Anti-TIF1, Anti-TIF1A, Anti-TIF1ALPHA, Anti-hTIF1, Anti-tripartite motif-containing 24

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2F2, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotype

IgG3κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TRIM24(8805)

General description

Tripartite motif-containing 24 (TRIM24) is a co-regulator that belongs to the transcription intermediary factor 1 family. It is also known as transcription intermediary factor 1α (TIF1α). TRIM24 has an amino-terminal RING-B boxes-coiled coil (RBCC/TRIM) motif, a carboxy-terminal plant homeodomain (PHD) finger-bromodomain unit and a nuclear receptor interaction box (NR box or LXXLL motif). This gene is located on human chromosome 7q33-q34.

Immunogen

TRIM24 (AAH28689, 432 a.a. ~ 569 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQRQQVQRRPAPVGLPNPRMQGPIQQPSISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRYPPNQNIPRQAIKPNPLQMAFLAQQAIKQW

Biochem/physiol Actions

Tripartite motif-containing 24 (TRIM24) acts as a potential prognostic biomarker for ESCC (esophageal squamous cell cancer). This protein induces the development of tumor and generates chemotherapy resistance through the phosphatidylinositide 3-kinase (PI3K)/Akt pathway. TRIM24 modulates p53 protein levels by changing the stability of p53.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Trim24 targets endogenous p53 for degradation.
Allton K, et al.
Proceedings of the National Academy of Sciences of the USA, 106(28), 11612-11616 (2009)
Clinical significance and prognostic value of TRIM24 expression in esophageal squamous cell carcinoma
Chi J, et al.
Aging (Albany. NY.), 8(9), 2204-2221 (2016)
Genomic analysis of the TRIM family reveals two groups of genes with distinct evolutionary properties
Sardiello M, et al.
BMC Evolutionary Biology (2008)
Jianwei Wang et al.
Oncology research, 22(1), 39-45 (2015-02-24)
Colorectal cancer remains one of the most common cancers in men and women, and it accounts for a large proportion of cancer-related deaths worldwide. Tripartite motif (TRIM) proteins are a novel class of "single protein RING finger" E3 ubiquitin ligases

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service