WH0000323M1

Monoclonal Anti-APBB2 antibody produced in mouse

clone 2D8, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-FE65L, Anti-FE65L1, Anti-MGC35575, Anti-amyloid beta (A4) precursor protein-binding, family B, member 2 (Fe65-like)
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2D8, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• GenBank accession no.: BC027946
• UniProt accession no.: Q92870
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... APBB2(323)

Description

General description

The protein encoded by this gene interacts with the cytoplasmic domains of amyloid beta (A4) precursor protein and amyloid beta (A4) precursor-like protein 2. This protein contains two phosphotyrosine binding (PTB) domains, which are thought to function in signal transduction. (provided by RefSeq)

Immunogen

APBB2 (AAH27946, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSEVLPADSGVDTLAVFMASSGTTDVTNRNSPATPPNTLNLRSSHNELLNAEIKHTETKNSTPPKCRKKYALTNIQAAMGLSDPAAQPLLGNGSANIKLV

Biochem/physiol Actions

The gene APBB2 (amyloid β precursor protein binding family B member 2), also referred to as FE65-like 1, encodes an adaptor protein that binds to the cytoplasmic domain of β-amyloid precursor protein (βAPP) and processes it to form β-amyloid (Aβ). Over-expression of APBB2 leads to an accumulation of Aβ in senile plaques seen in patients with Alzheimer′s disease (AD). Mutations in this gene have been associated with AD.

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Safety Information

• Storage Class Code: 10 - Combustible liquids
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves