Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

SAB2108215

Sigma-Aldrich

Anti-SERPINA3 antibody produced in rabbit

affinity isolated antibody

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

45kDa

species reactivity

human, mouse, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

immunoblotting: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SERPINA3(12)

General description

Serpin peptidase inhibitor, clade A member 3 (SERPINA3) is also termed as α1-antichymotrypsin (α1-ACT). It is a 68 kDa serine protease inhibitor, secreted by the liver. It belongs to the serpin superfamily of protease inhibitors. SERPINA3 is located on human chromosome 14q32.1.

Immunogen

Synthetic peptide directed towards the middle region of human SERPINA3

Biochem/physiol Actions

Serpin peptidase inhibitor, clade A member 3 (SERPINA3) can block the functions of various serine proteases like chymotrypsin and cathepsin G. It serves as a novel predictor of clinical outcomes and a potential therapeutic target of EC (endometrial carcinoma). SERPINA3 plays a major role in melanoma invasion and migration in extracellular matrix.

Sequence

Synthetic peptide located within the following region: FRDEELSCTVVELKYTGNASALFILPDQDKMEEVEAMLLPETLKRWRDSL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Is Alpha-1 antichymotrypsin gene polymorphism a risk factor for primary intracerebral hemorrhage? A case-control study and meta-analysis.
Hu X, et al.
Medical Science Monitor : International Medical Journal of Experimental and Clinical Research, 21, 2149-2149 (2015)
Up-regulation of SERPINA3 correlates with high mortality of melanoma patients and increased migration and invasion of cancer cells.
Zhou J, et al.
Oncotarget, 8(12), 18712-18712 (2017)
SERPINA3 promotes endometrial cancer cells growth by regulating G2/M cell cycle checkpoint and apoptosis.
Yang GD
International Journal of Clinical and Experimental Pathology, 7(4), 1348-1358 (2014)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service